Specification
    
        | Organism | Mus musculus (Mouse) | 
| Expression Host | E.coli | 
| Tag Info | N-terminal 6xHis-SUMO-tagged | 
| Purity | Greater than 85% by SDS-PAGE | 
| Uniprot ID | P40237 | 
| Gene Names | Cd82 | 
| Alternative Names | C33 antigenIA4Inducible membrane protein R2Metastasis suppressor Kangai-1 homolog; CD82 | 
| Expression Region | Extracellular Domain(111-227aa ) | 
| Molecular Weight | 29.5 kDa | 
| Protein Sequence | DKLKKEMGNTVMDIIRNYTANATSSREEAWDYVQAQVKCCGWVSHYNWTENEELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENF | 
| Form | Liquid or Lyophilization | 
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. | 
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. | 
        Background
    
        | Relevance | Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway. | 
| Involvement in Disease | |
| Subcellular Location | Membrane, Multi-pass membrane protein | 
| Protein Families | Tetraspanin (TM4SF) family | 
| Tissue Specificity | Cd82 | 
        QC Data
    
        | Note | Please contact us for QC Data | 
| Product Image (Reference Only) | ![]()  |  
