Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P40237 |
| Gene Names | Cd82 |
| Alternative Names | C33 antigenIA4Inducible membrane protein R2Metastasis suppressor Kangai-1 homolog; CD82 |
| Expression Region | Extracellular Domain(111-227aa ) |
| Molecular Weight | 29.5 kDa |
| Protein Sequence | DKLKKEMGNTVMDIIRNYTANATSSREEAWDYVQAQVKCCGWVSHYNWTENEELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENF |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway. |
| Involvement in Disease | |
| Subcellular Location | Membrane, Multi-pass membrane protein |
| Protein Families | Tetraspanin (TM4SF) family |
| Tissue Specificity | Cd82 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |