Recombinant Mouse CD81 antigen(Cd81),partial

Specification
Organism Mus musculus (Mouse)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P35762
Gene Names Cd81
Alternative Names 26KDA cell surface protein TAPA-1Target of the antiproliferative antibody 1; CD81
Expression Region Partial(116-201aa )
Molecular Weight 36.4 kDa
Protein Sequence KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance May play an important role in the regulation of lymphoma cell growth. May be involved in the acrosome reaction.
Involvement in Disease
Subcellular Location Basolateral cell membrane, Multi-pass membrane protein
Protein Families Tetraspanin (TM4SF) family
Tissue Specificity Cd81
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PE0MO5085

Recombinant Mouse CD81 antigen(Cd81),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse CD81 antigen(Cd81),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.