Recombinant Mouse CB1 cannabinoid receptor-interacting protein 1(Cnrip1)

Specification
Organism Mus musculus (Mouse)
Expression Host Yeast
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q5M8N0
Gene Names Cnrip1
Alternative Names Cnrip1CB1 cannabinoid receptor-interacting protein 1; CRIP-1
Expression Region Full Length(1-464aa )
Molecular Weight 22.6 kDa
Protein Sequence MGDLPGLVRLSIALRIQPNDGPVFFKVDGQRFGQNRTIKLLTGSSYKVEVKIKPTTLQVENISIGGVLVPLELKGKEPDGERVVYTGIYDTEGVAPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Suppresses cannabinoid receptor CNR1-mediated tonic inhibition of voltage-gated calcium channels.
Involvement in Disease
Subcellular Location
Protein Families CNRIP family
Tissue Specificity Cnrip1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$331.00
In stock
SKU
EB-PY7MO705922

Recombinant Mouse CB1 cannabinoid receptor-interacting protein 1(Cnrip1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse CB1 cannabinoid receptor-interacting protein 1(Cnrip1)
Copyright © 2021-present Echo Biosystems. All rights reserved.