Specification
    
        | Gene Names | Cav3 | 
| Alternative Names | M-caveolin | 
| Organism | Mus musculus (Mouse) | 
| Expression Host | Mammalian cell | 
| Molecular Weight | 43.4 kDa | 
| Expression Region | Full Length(1-151aa ) | 
| Expression Region | N-terminal hFc-tagged(Full Length ) | 
| Purity | Greater than 85% as determined by SDS-PAGE. | 
| Endotoxin | Not test. | 
| Form | Liquid or Lyophilized powder | 
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. | 
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. | 
| Storage | Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. | 
| Protein Sequence | MMTEEHTDLEARIIKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWKVSFTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSNIKVVLRREG | 
        Background
    
        | Research Areas | Cardiovascular | 
        QC Data
    
        | Note | Please contact us for QC Data | 
| Product Image (Reference Only) |  | 
 
