Recombinant Mouse Carboxylesterase 1C(Ces1c),partial

Specification
Organism Mus musculus (Mouse)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P23953
Gene Names Ces1c
Alternative Names Liver carboxylesterase NLung surfactant convertasePES-N
Expression Region Partial(19-550aa )
Molecular Weight 60.6 kDa
Protein Sequence HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the Extracellular domain metabolism of lung surfactant.
Involvement in Disease
Subcellular Location Endoplasmic reticulum lumen
Protein Families Type-B carboxylesterase/lipase family
Tissue Specificity Ces1c
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$331.00
In stock
SKU
EB-PY7MO338682

Recombinant Mouse Carboxylesterase 1C(Ces1c),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Carboxylesterase 1C(Ces1c),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.