Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9R100 |
| Gene Names | Cdh17 |
| Alternative Names | BILL-cadherin (Liver-intestine cadherin) (LI-cadherin) (P130) |
| Expression Region | Partial(173-253aa ) |
| Molecular Weight | 13.1 kDa |
| Protein Sequence | INDVMYFQIDSKTGAISLTPEGSQELDPVKNPSYNLVVSVKDMGGQSENSFSDTTYVDISIRENIWKAPEPVEIRENSTDP |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. LI-cadherin may have a role in the morphological organization of liver and intestine. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | Cdh17 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |