Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P17515 |
| Gene Names | Cxcl10 |
| Alternative Names | 10KDA interferon gamma-induced protein Short name: Gamma-IP10 Short name: IP-10 |
| Expression Region | Full Length of Mature Protein(22-98aa ) |
| Molecular Weight | 35.7 kDa |
| Protein Sequence | IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | In addition to its role as a proinflammatory cytokine, may participate in T-cell effector function and perhaps T-cell development. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | Cxcl10 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |