Recombinant Mouse C-C motif chemokine 7(Ccl7),partial

Specification
Organism Mus musculus (Mouse)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q03366
Gene Names Ccl7
Alternative Names Intercrine/chemokine MAR;CMonocyte chemoattractant protein 3Monocyte chemotactic protein 3 ;MCP-3;Protein FICSmall-inducible cytokine A7
Expression Region Partial(28-97aa )
Molecular Weight 12.1 kDa
Protein Sequence PNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Chotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity .
Involvement in Disease
Subcellular Location Secreted
Protein Families Intercrine beta (chemokine CC) family
Tissue Specificity Ccl7
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PR94m91119

Recombinant Mouse C-C motif chemokine 7(Ccl7),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse C-C motif chemokine 7(Ccl7),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.