Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P86793 |
| Gene Names | Ccl21c |
| Alternative Names | (6Ckine)(Beta-chemokine exodus-2)(Small-inducible cytokine A21c)(Thymus-derived chemotactic agent 4)(TCA4) |
| Expression Region | 24-133aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.42 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-134℃. |
| Protein Length | Full Length of Mature Protein |
| Molecular Weight | 25.0 kDa |
| Protein Sequence | SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG |
Background
| Research Areas | Others |
| Relevance | Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Potent mesangial cell chemoattractant. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs. |
| Function | |
| Reference | "Differential regulation of CCL21 in lymphoid/nonlymphoid tissues for effectively attracting T cells to peripheral tissues." Lo J.C., Chin R.K., Lee Y., Kang H.S., Wang Y., Weinstock J.V., Banks T., Ware C.F., Franzoso G., Fu Y.X. J Clin Invest 112:1495-1505(2003) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |