Specification
Organism | Mus musculus (Mouse) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P10148 |
Gene Names | CCL2 |
Alternative Names | HC11Monocyte chemoattractant protein 1Monocyte chemotactic and activating factor ;MCAFMonocyte chemotactic protein 1 ;MCP-1Monocyte secretory protein JESmall-inducible cytokine A2 |
Expression Region | Partial(24-96aa ) |
Molecular Weight | 12.4 kDa |
Protein Sequence | QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Chotactic factor that attracts monocytes and basophils but not neutrophils or eosinophils. Augments monocyte anti-tumor activity. Has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis or atherosclerosis. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis. |
Involvement in Disease | |
Subcellular Location | Secreted |
Protein Families | Intercrine beta (chemokine CC) family |
Tissue Specificity | CCL2 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |