Recombinant Mouse Beta-nerve growth factor(Ngf) (Active)

Specification
Organism Mus musculus (Mouse)
Expression Host E.coli
Tag Info Tag-Free
Purity Greater than 95% as determined by SDS-PAGE.
Uniprot ID P01139
Uniprot Entry Name
Gene Names Ngf
Alternative Names Beta-nerve growth factor; Beta-NGF; Ngf
Expression Region Full Length of Mature Protein (122-241aa)
Molecular Weight 13.5 kDa
Endotoxin Less than 1.0 EU/µg as determined by LAL method.
Sequence SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG
Product Form Lyophilized powder (Lyophilized from a 0.2 μm Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0)
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance NGF is the first member discovered in the Neurotrophin family, which includes brain-derived neurotrophic factor (BDNF), neurotrophin-3 (NT-3), and neurotrophin-4 (NT-4). These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. Mouse beta -NGF is a homodimer of two 120 amino acid polypeptides. It shares approximately 90% homology at the amino acid level with human beta -NGF and 95.8% with rat beta -NGF. NGF signaling has been shown to play an important role in neuroprotection and repair. β-NGF acts as a growth and differentiation factor for B lymphocytes, and enhances B-cell survival. It is a potent neurotrophic factor that signals through its receptor β-NGFR, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems.
Function Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.
Involvement in disease
Subcellular Location Secreted
Protein Families NGF-beta family
Tissue Specificity
Pathway
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$122.00
In stock
SKU
EB-CAPMO4226

Recombinant Mouse Beta-nerve growth factor(Ngf) (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Beta-nerve growth factor(Ngf) (Active)
Copyright © 2021-present Echo Biosystems. All rights reserved.