Recombinant Mouse BCL2/adenovirus E1B 19 kDa protein-interacting protein 3(Bnip3),partial

Specification
Organism Mus musculus (Mouse)
Expression Host in vitro E.coli expression system
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O55003
Gene Names Bnip3
Alternative Names Nip3
Expression Region Partial(50-187aa )
Molecular Weight 21.3 kDa
Protein Sequence RSSSKSSHCDSPPRSQTPQDTNRAEIDSHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSADFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Apoptosis-inducing protein that can overcome BCL2 suppression. May play a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. Involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates in mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane may play a critical role in the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane regulates the opening of a pore in the mitochondrial double membrane in order to mediate the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix. Plays an important role in the calprotectin (S100A8/A9)-induced cell death pathway
Involvement in Disease
Subcellular Location Mitochondrion, Mitochondrion outer membrane, Single-pass membrane protein
Protein Families NIP3 family
Tissue Specificity Bnip3
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$1,607.00
In stock
SKU
EB-PCMO227787

Recombinant Mouse BCL2/adenovirus E1B 19 kDa protein-interacting protein 3(Bnip3),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse BCL2/adenovirus E1B 19 kDa protein-interacting protein 3(Bnip3),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.