Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-sumostar-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P63115 |
| Gene Names | Slc7a10 |
| Alternative Names | D-serine transporter Solute carrier family 7 member 10 |
| Expression Region | Partial(475-530aa ) |
| Molecular Weight | 22.5 kDa |
| Protein Sequence | WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITDKPLKTQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Sodium-independent, high affinity transport of small neutral D- and L-amino acids and amino acid-related compounds. May play a role in the modulation of glutamatergic transmission through mobilization of D-serine at the glutamatergic synapse. |
| Involvement in Disease | |
| Subcellular Location | Membrane, Multi-pass membrane protein |
| Protein Families | Amino acid-polyamine-organocation (APC) superfamily |
| Tissue Specificity | Slc7a10 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |