Specification
Organism | Mus musculus (Mouse) |
Expression Host | Yeast |
Tag Info | C-terminal 6xHis-Myc-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P55088 |
Gene Names | Aqp4 |
Alternative Names | Mercurial-insensitive water channel |
Expression Region | Partial(253-323aa ) |
Molecular Weight | 10.9 kDa |
Protein Sequence | CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system. |
Involvement in Disease | |
Subcellular Location | Membrane, Multi-pass membrane protein |
Protein Families | MIP/aquaporin (TC 1.A.8) family |
Tissue Specificity | Aqp4 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |