Specification
    
        | Organism | Mus musculus (Mouse) | 
| Expression Host | Mammalian cell | 
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged | 
| Purity | Greater than 85% by SDS-PAGE | 
| Uniprot ID | P08226 | 
| Gene Names | Apoe | 
| Alternative Names | Apo-E | 
| Expression Region | Full Length of Mature Protein(19-311aa ) | 
| Molecular Weight | 39 | 
| Protein Sequence | EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ | 
| Form | Liquid or Lyophilization | 
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. | 
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. | 
        Background
    
        | Relevance | APOE is an apolipoprotein, a protein associating with lipid particles, that mainly functions in lipoprotein-mediated lipid transport between organs via the plasma and interstitial fluids. APOE is a core component of plasma lipoproteins and is involved in their production, conversion and clearance. Apoliproteins are amphipathic molecules that interact both with lipids of the lipoprotein particle core and the aqueous environment of the plasma. As such, APOE associates with chylomicrons, chylomicron remnants, very low density lipoproteins and intermediate density lipoproteins but shows a preferential binding to high-density lipoproteins. It also binds a wide range of cellular receptors including the LDL receptor/LDLR and the very low-density lipoprotein receptor/VLDLR that mediate the cellular uptake of the APOE-containing lipoprotein particles. Finally, APOE has also a heparin-binding activity and binds heparan-sulfate proteoglycans on the surface of cells, a property that supports the capture and the receptor-mediated uptake of APOE-containing lipoproteins by cells | 
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | Apoe | 
        QC Data
    
        | Note | Please contact us for QC Data | 
| Product Image (Reference Only) |  | 
 
