Specification
    
        | Organism | Mus musculus (Mouse) | 
| Expression Host | E.coli | 
| Tag Info | N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged | 
| Purity | Greater than 85% by SDS-PAGE | 
| Uniprot ID | Q3TMQ6 | 
| Gene Names | Ang4 | 
| Alternative Names | Ang4Angiogenin-4; EC 3.1.27.- | 
| Expression Region | Full Length of Mature Protein(25-144aa ) | 
| Molecular Weight | 31.4 kDa | 
| Protein Sequence | QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP | 
| Form | Liquid or Lyophilization | 
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. | 
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. | 
        Background
    
        | Relevance | Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro). | 
| Involvement in Disease | |
| Subcellular Location | Cytoplasmic vesicle, secretory vesicle lumen, Secreted, Nucleus, nucleolus | 
| Protein Families | Pancreatic ribonuclease family | 
| Tissue Specificity | Ang4 | 
        QC Data
    
        | Note | Please contact us for QC Data | 
| Product Image (Reference Only) |  | 
 
