Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q3TB92 |
| Gene Names | Milr1 |
| Alternative Names | Allergy inhibitory receptor 1 Mast cell antigen 32 Short name: MCA-32 Short name: Mast cell Ag-32 Mast cell immunoglobulin-like receptor 1 Gm885, Mca32 |
| Expression Region | Extracellular Domain(34-150aa ) |
| Molecular Weight | 20.1 kDa |
| Protein Sequence | ITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction. |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted |
| Protein Families | |
| Tissue Specificity | Milr1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |