Specification
Organism | Mus musculus (Mouse) |
Expression Host | E.coli |
Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q3TB92 |
Gene Names | Milr1 |
Alternative Names | Allergy inhibitory receptor 1 Mast cell antigen 32 Short name: MCA-32 Short name: Mast cell Ag-32 Mast cell immunoglobulin-like receptor 1 Gm885, Mca32 |
Expression Region | Extracellular Domain(34-150aa ) |
Molecular Weight | 20.1 kDa |
Protein Sequence | ITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLS |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction. |
Involvement in Disease | |
Subcellular Location | Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted |
Protein Families | |
Tissue Specificity | Milr1 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |