Recombinant Mouse Adiponectin(Adipoq),partial

Specification
Organism Mus musculus (Mouse)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q60994
Gene Names Adipoq
Alternative Names 30KDA adipocyte complement-related protein;Adipocyte complement-related 30KDA protein ;ACRP30Adipocyte, C1q and collagen domain-containing protein;Adipocyte-specific protein AdipoQ
Expression Region Partial(104-247aa )
Molecular Weight 20.5 kDa
Protein Sequence KGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue rodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
Involvement in Disease
Subcellular Location Secreted
Protein Families
Tissue Specificity Adipoq
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PR74m79599

Recombinant Mouse Adiponectin(Adipoq),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Adiponectin(Adipoq),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.