Recombinant Mouse Acid ceramidase(Asah1),partial

Specification
Organism Mus musculus (Mouse)
Expression Host in vitro E.coli expression system
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9WV54
Gene Names Asah1
Alternative Names Acylsphingosine deacylase N-acylsphingosine amidohydrolase
Expression Region Partial(19-141aa )
Molecular Weight 33.8 kDa
Protein Sequence QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.
Involvement in Disease
Subcellular Location Lysosome
Protein Families Acid ceramidase family
Tissue Specificity Asah1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$754.00
In stock
SKU
EB-PC6MO895421

Recombinant Mouse Acid ceramidase(Asah1),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Acid ceramidase(Asah1),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.