Specification
Organism | Mus musculus (Mouse) |
Expression Host | E.coli |
Tag Info | N-terminal 10xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q9CQV8 |
Gene Names | Ywhab |
Alternative Names | Protein kinase C inhibitor protein 1 |
Expression Region | Full Length(1-246aa ) |
Molecular Weight | 33.6 kDa |
Protein Sequence | MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis. Blocks the nuclear translocation of the phosphorylated form (by AKT1) of SRPK2 and antagonizes its stimulatory effect on cyclin D1 expression resulting in blockage of neuronal apoptosis elicited by SRPK2. Negative regulator of signaling cascades that mediate activation of MAP kinases via AKAP13. |
Involvement in Disease | |
Subcellular Location | Cytoplasm, Melanosome |
Protein Families | 14-3-3 family |
Tissue Specificity | Ywhab |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |