Specification
| Gene Names | Agpat2 |
| Alternative Names | 1-acylglycerol-3-phosphate O-acyltransferase 2;1-AGP acyltransferase 2;1-AGPAT 2;Lysophosphatidic acid acyltransferase beta;LPAAT-beta |
| Organism | Mus musculus (Mouse) |
| Expression Host | Mammalian cell |
| Molecular Weight | 32.8 kDa |
| Expression Region | Full Length of Mature Protein(24-278aa ) |
| Expression Region | N-terminal 10xHis-tagged and C-terminal Twin-Strep-tagged(Full Length of Mature Protein ) |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin | |
| Form | Liquid |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | |
| Storage | Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. |
| Protein Sequence | ARFYAKVGLYCVLCLSFSAAASIVCLLRHGGRTVDNMSIISWFVRSFKYVYGLRFEVSGQKKLEVDGPCVIISNHQSILDMMGLMEILPKRCVQIAKRELMFTGPVGLIMYLGGVYFINRQQARTAMSVMADLGDLMVKENLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPIIPVVYSSFSSFYNVKTKLFTSGTIKVQVLDAVPTNGLTDADVTKLVDTCYQSMRATFLQISQIPQENSAIKEPGVLPAQ |
Background
| Research Areas | Cancer |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |