Recombinant Monkeypox virus Envelope protein A28 homolog(A30L),partial

Specification
Organism Monkeypox virus (strain Zaire-96-I-16) (MPX)
Expression Host E.coli
Protein Tag N-terminal 6xHis-tagged
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Level
Biological Activity
Uniprot ID Q8V4U9
Gene Names A30L
Alternative Names (Protein A30)
Expression Region 22-146aa
Product Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.1635 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1757℃.
Protein Length Partial
Molecular Weight 18.2 kDa
Protein Sequence QSYSIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMRQCIDFTFSDVINIDIYNPCIAPNINNTECQFLKSVL
Background
Research Areas Others
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$378.00
In stock
SKU
EB-N232678

Protein expressed from mulitple host is available with various size. Please inquiry us if you need any customized needs.

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Monkeypox virus Envelope protein A28 homolog(A30L),partial
Copyright © 2026-present Echo Bio. All rights reserved.