Recombinant Micrurus tener tener Kunitz-type neurotoxin MitTx-alpha

Specification
Organism Micrurus tener tener (Texas coral snake)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID G9I929
Gene Names N/A
Alternative Names ; Kunitz-type neurotoxin MitTx-alpha
Expression Region Full Length of Mature Protein(25-84aa )
Molecular Weight 9.1 kDa
Protein Sequence QIRPAFCYEDPPFFQKCGAFVDSYYFNRSRITCVHFFYGQCDVNQNHFTTMSECNRVCHG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance This heterodimeric toxin potently activates mouse acid-sensing ion channel ASIC1/ACCN2 expressed in Xenopus oocytes. Both alternatively spliced isoforms ASIC1a and ASIC1b are activated, with a higher potency for ASIC1a (EC(50)=9.4 nM) vs ASIC1b (EC(50)=23 nM). The ASIC3/ACCN3 subtype is also sensitive to the heterodimer, but with a lower potency (EC(50)=830 nM). On ASIC2a/ACCN1, the toxin shows a very weak activation, but produces a remarkable potentiation (>100-fold) of protons when the extracellular pH drops below neutrality. The toxin interacts with the extracellular region of the channel, since responses are only observed in the outside-out configuration. In vivo, the heterodimer elicits robust pain-related behavior in mice by activation of ASIC1/ACCN2 channels on capsaicin-sensitive nerve fibers
Involvement in Disease
Subcellular Location Secreted
Protein Families Venom Kunitz-type family
Tissue Specificity N/A
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYMUA516971

Recombinant Micrurus tener tener Kunitz-type neurotoxin MitTx-alpha

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Micrurus tener tener Kunitz-type neurotoxin MitTx-alpha
Copyright © 2021-present Echo Biosystems. All rights reserved.