Specification
| Organism | Methanothermus fervidus |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P19267 |
| Gene Names | hmfB |
| Alternative Names | Archaeal histone B |
| Expression Region | Full Length(1-69aa ) |
| Molecular Weight | 11.7 kDa |
| Protein Sequence | MELPIAPIGRIIKDAGAERVSDDARITLAKILEEMGRDIASEAIKLARHAGRKTIKAEDIELAVRRFKK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Binds and compacts DNA (95 to 150 base pairs) to form nucleosome-like structures that contain positive DNA supercoils (PubMed:2377617, PubMed:7809089, PubMed:10704305, PubMed:28798133). Increases the resistance of DNA to thermal denaturation in vitro (PubMed:2377617). |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | hmfB |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |