Recombinant Macaca mulatta Uncharacterized protein(OSM)

Specification
Organism Macaca mulatta (Rhesus macaque)
Expression Host Yeast
Tag Info C-terminal 6xHis-Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID F7GF43
Gene Names OSM
Alternative Names /
Expression Region Full Length(1-231aa )
Molecular Weight 27.1
Protein Sequence MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity OSM
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYWf329618

Recombinant Macaca mulatta Uncharacterized protein(OSM)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Macaca mulatta Uncharacterized protein(OSM)
Copyright © 2026-present Echo Bio. All rights reserved.