Specification
| Organism | Macaca mulatta (Rhesus macaque) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P48092 |
| Gene Names | IL15 |
| Alternative Names | IL15; Interleukin-15; IL-15 |
| Expression Region | Full Length of Mature Protein(49-162aa ) |
| Molecular Weight | 14.9 kDa |
| Protein Sequence | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | IL-15/IL-21 family |
| Tissue Specificity | IL15 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
