Recombinant Macaca mulatta Interleukin-10(IL10)

Specification
Organism Macaca mulatta (Rhesus macaque)
Expression Host E.coli
Tag Info N-terminal 6xHis-B2M-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P51496
Gene Names IL10
Alternative Names Cytokine synthesis inhibitory factor
Expression Region Full Length of Mature Protein(19-178aa )
Molecular Weight 32.7 kDa
Protein Sequence SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Involvement in Disease
Subcellular Location Secreted
Protein Families IL-10 family
Tissue Specificity IL10
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEMOW11705

Recombinant Macaca mulatta Interleukin-10(IL10)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Macaca mulatta Interleukin-10(IL10)
Copyright © 2021-present Echo Biosystems. All rights reserved.