Specification
Organism | Macaca mulatta (Rhesus macaque) |
Expression Host | Baculovirus |
Tag Info | C-terminal 10xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P51496 |
Gene Names | IL10 |
Alternative Names | Cytokine synthesis inhibitory factor |
Expression Region | Full Length of Mature Protein(19-178aa ) |
Molecular Weight | 21.2 kDa |
Protein Sequence | SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. |
Involvement in Disease | |
Subcellular Location | Secreted |
Protein Families | IL-10 family |
Tissue Specificity | IL10 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |