Specification
Organism | Macaca mulatta (Rhesus macaque) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q8MIZ1 |
Gene Names | CXCL10 |
Alternative Names | 10KDA interferon gamma-induced protein ;Gamma-IP10 ;IP-10Small-inducible cytokine B10 |
Expression Region | Full Length of Mature Protein(22-98aa ) |
Molecular Weight | 12.7 kDa |
Protein Sequence | IPLSRTVRCTCISISNQPVNPRSLEKLEIIPPSQFCPHVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Chotactic for monocytes and T-lymphocytes. Binds to CXCR3 . |
Involvement in Disease | |
Subcellular Location | Secreted |
Protein Families | Intercrine alpha (chemokine CxC) family |
Tissue Specificity | CXCL10 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |