Recombinant Macaca fascicularis Tumor necrosis factor ligand superfamily member 6(FASLG),partial

Specification
Organism Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Host in vitro E.coli expression system
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P63308
Gene Names FASLG
Alternative Names CD95 ligand (CD95-L) (Fas antigen ligand) (Fas ligand) (FasL) (CD_antigen: CD178) (CD95L) (FASL) (TNFSF6)
Expression Region Partial(102-211aa )
Molecular Weight 18.5 kDa
Protein Sequence QLFHLQKELAELRESTSQKHTASSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCTNLPLSHKVY
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. Involved in cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development. Initiates fratricidal/suicidal activation-induced cell death in antigen-activated T-cells contributing to the termination of immune responses. TNFRSF6/FAS-mediated apoptosis has also a role in the induction of peripheral tolerance. Binds to TNFRSF6B/DcR3, a decoy receptor that blocks apoptosis.Tumor necrosis factor ligand superfamily member 6, soluble form: Induces FAS-mediated activation of NF-kappa-B, initiating non-apoptotic signaling pathways. Can induce apoptosis but does not appear to be essential for this process.FasL intracellular domain: Cytoplasmic form induces gene transcription inhibition.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity FASLG
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$754.00
In stock
SKU
EB-PCOV284467

Recombinant Macaca fascicularis Tumor necrosis factor ligand superfamily member 6(FASLG),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Macaca fascicularis Tumor necrosis factor ligand superfamily member 6(FASLG),partial
Copyright © 2026-present Echo Bio. All rights reserved.