Specification
| Organism | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P07865 |
| Gene Names | EPO |
| Alternative Names | EPOErythropoietin |
| Expression Region | Full Length of Mature Protein(28-192aa ) |
| Molecular Weight | 34.2 kDa |
| Protein Sequence | APPRLICDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | EPO/TPO family |
| Tissue Specificity | EPO |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |