Specification
| Organism | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-sumostar-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P18659 |
| Gene Names | APOC3 |
| Alternative Names | Apolipoprotein C3 |
| Expression Region | Full Length of Mature Protein(21-99aa ) |
| Molecular Weight | 24.7 kDa |
| Protein Sequence | SEAEDTSLLGFMQGYMQHATKTAKDALTSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKLSGFWDLNPEAKPTLAEAA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Apolipoprotein C3 family |
| Tissue Specificity | APOC3 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
