Recombinant Macaca fascicularis Alpha-synuclein(SNCA)

Specification
Organism Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P61142
Gene Names SNCA
Alternative Names SNCA; Alpha-synuclein
Expression Region Full Length(1-140aa )
Molecular Weight 16.5 kDa
Protein Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance May be involved in the regulation of dopamine release and transport.
Involvement in Disease
Subcellular Location Cytoplasm, cytosol, Membrane, Nucleus, Cell junction, synapse, Secreted
Protein Families Synuclein family
Tissue Specificity SNCA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYMOV22037

Recombinant Macaca fascicularis Alpha-synuclein(SNCA)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Macaca fascicularis Alpha-synuclein(SNCA)
Copyright © 2021-present Echo Biosystems. All rights reserved.