Specification
| Organism | Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV) |
| Expression Host | in vitro E.coli expression system |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P09991 |
| Gene Names | GPC |
| Alternative Names | GPC; GP-C; Segment; SPre-glycoprotein polyprotein GP complex; Pre-GP-C) [Cleaved into: Stable signal peptide; SSP); Glycoprotein G1; GP1); Glycoprotein G2; GP2)] |
| Expression Region | Partial(10-90aa ) |
| Molecular Weight | 24.9 kDa |
| Protein Sequence | ALPHIIDEVINIVIIVLIVITGIKAVYNFATCGIFALISFLLLAGRSCGMYGLKGPDIYKGVYQFKSVEFDMSHLNLTMPN |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Stable signal peptide (SSP) is cleaved but is apparently retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational cleavage of GP1 and GP2, glycoprotein transport to the cell plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.1 Publication Glycoprotein G1 mediates virus attachment to host receptor alpha-dystroglycan DAG1. This attachment induces virion internalization predominantly through clathrin- and caveolin-independent endocytosis.1 Publication Glycoprotein G2 is a class I viral fusion protein, that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversable conformational changes induced upon acidification in the endosome. |
| Involvement in Disease | |
| Subcellular Location | Stable signal peptide: Virion membrane, Multi-pass membrane protein, Host cell membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Glycoprotein G1: Virion membrane, Peripheral membrane protein, Host cell membrane, Peripheral membrane protein, SUBCELLULAR LOCATION: Glycoprotein G2: Virion membrane, Single-pass membrane protein, Host cell membrane, Single-pass membrane protein |
| Protein Families | Arenaviridae GPC protein family |
| Tissue Specificity | GPC |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |