Specification
| Organism | Loxosceles amazonica (Recluse spider) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | C0JAZ9 |
| Gene Names | N/A |
| Alternative Names | Dermonecrotic toxin LamSicTox-alphaIC1; EC 4.6.1.-; Phospholipase D; PLD; Sphingomyelin phosphodiesterase D; SMD; SMase D; Sphingomyelinase D; Fragment |
| Expression Region | Full Length(1-273aa ) |
| Molecular Weight | 34.8 kDa |
| Protein Sequence | WIMGHMVNNINQIEEFVSLGANSIETDVSFDKKANPEYTYHGTPCDCGRDCLRWEYFKDFLNGLRKATTPGDAKYREKLILVVFDLKTGSLYDNQAYDAGKSLAKNLLEYYWNNGNNGGRAYIVLSIPNLAHYKLVTGFKETLKDEGHEDLLEKVGHDFSGNDDIPDIESAYKKAGVTGHVWQSDGITNCLPRTLKRVILAIANRDSGSGIINKVYYWTVDKRSTTRDSLEAGVDGIMTNYPDVIADVLSEAAYKDKYRIATYDDNPWETFKA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Catalyzes the hydrolysis of sphingomyelin. May also acts on other phosphatidyl esters. Induces complent-dependent holysis, dermonecrosis, blood vessel permeability and platelet aggregation . |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Arthropod phospholipase D family, Class II subfamily |
| Tissue Specificity | N/A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |