Recombinant Listeria monocytogenes serotype 4b Internalin-A(inlA),partial

Specification
Organism Listeria monocytogenes serotype 4b (strain F2365)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q723K6
Gene Names inlA
Alternative Names inlA; LMOf2365_0471; Internalin A
Expression Region Partial(562-770aa )
Molecular Weight 24.5 kDa
Protein Sequence QFSINSYTATFDNDGVTTSQTVDYQGLLQEPTAPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSANSYTATFDVDGKTTTQAVDYQGLLKEPKTPTKAGYTFKGWYDEKTDGKKWDFATDKMPANDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTTPPSANIPGSNTSNTSTGNSASTTSTMNAYDPYNSKEASLPTT
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Mediates the entry of Listeria monocytogenes into cells.
Involvement in Disease
Subcellular Location Secreted, cell wall, Peptidoglycan-anchor
Protein Families
Tissue Specificity inlA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYAAD758456

Recombinant Listeria monocytogenes serotype 4b Internalin-A(inlA),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Listeria monocytogenes serotype 4b Internalin-A(inlA),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.