Recombinant Lentinula edodes Serine protease inhibitor

Specification
Organism Lentinula edodes (Shiitake mushroom) (Lentinus edodes)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P81639
Gene Names N/A
Alternative Names ; Serine protease inhibitor
Expression Region Full Length(1-142aa )
Molecular Weight 20.0 kDa
Protein Sequence SLETGRYLIHNGNNIVSRNLAEDRSLNPKRIVLLEPTDKIQLTWIIEKSGDEYILNNRGAPTAHIEDHVFALLIHQEGATKWSIEAVPRHGRNAYIIKGSDGKGWVAPDKAGEQIIYRTLIVGPSEPPTFPLNQVFQIIKLE
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Serine protease inhibitor. Active against beta-trypsin and alpha-chymotrypsin with dissociation constants of 0.35 nM and 40 nM respectively. Inhibits factor XIa, but not other enzymes involved in coagulation and fibrinolysis. Does not inhibit subtilisin, lysyl endopeptidase, arginyl endopeptidase or papain.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity N/A
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PELDV305649

Recombinant Lentinula edodes Serine protease inhibitor

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Lentinula edodes Serine protease inhibitor
Copyright © 2021-present Echo Biosystems. All rights reserved.