Recombinant Laribacter hongkongensis Orotate phosphoribosyltransferase(pyrE)

Specification
Organism Laribacter hongkongensis (strain HLHK9)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID C1D6F5
Gene Names pyrE
Alternative Names Short name:OPRT Short name:OPRTase
Expression Region Full Length(1-213aa )
Molecular Weight 38.9 kDa
Protein Sequence MSDFRQDFIRFAVEEQVLRFGEFVTKAGRPSPYFFNAGLFNHGASLLSLARFYARSISESGIAFDMLFGPAYKGIVLAGATAMMLAEQGRDVPFAFNRKEAKDHGEGGTLIGAPLKGRVLIIDDVISAGTSVRESVEIIRANGAEPAGVAIALDRMERGQGELSATQEVAQKFGLPVVAIASLDDLLGFLAGSPDLADNLTRVEAYRTQYGVR
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Catalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP).
Involvement in Disease
Subcellular Location
Protein Families Purine/pyrimidine phosphoribosyltransferase family, PyrE subfamily
Tissue Specificity pyrE
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PELNO507058

Recombinant Laribacter hongkongensis Orotate phosphoribosyltransferase(pyrE)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Laribacter hongkongensis Orotate phosphoribosyltransferase(pyrE)
Copyright © 2021-present Echo Biosystems. All rights reserved.