Specification
Organism | Lama glama (Llama) |
Expression Host | Yeast |
Protein Tag | C-terminal 6xHis-tagged |
Purity | Greater than 85% as determined by SDS-PAGE. |
Endotoxin Level | Not test. |
Biological Activity | |
Uniprot ID | Q865X5 |
Gene Names | IL4 |
Alternative Names | (IL-4)(B-cell stimulatory factor 1)(BSF-1)(Lymphocyte stimulatory factor 1) |
Expression Region | 25-133aa |
Product Form | Liquid or Lyophilized powder |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.1223 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1342℃. |
Protein Length | Full Length of Mature Protein |
Molecular Weight | 13.8 kDa |
Protein Sequence | HKCDITLQEIIKTLNTLTARKNSCMELTVADVFAAPKNTTEKETFCKAATALRHIYRHHNCLSKHLSGLDRNLSGLANTTCSVNDSKKSTLRDFLERLKKIMKEKYSKC |
Background
Research Areas | Cancer |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |