Specification
| Organism | Lake Victoria marburgvirus (strain Angola/2005) (MARV) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q1PD51 |
| Gene Names | VP40 |
| Alternative Names | Membrane-associated protein VP40 |
| Expression Region | Full Length(1-303aa ) |
| Molecular Weight | 49.8 kDa |
| Protein Sequence | MASSSNYNTYMQYLNPPPYADHGANQLIPADQLSNQQGITPNYVGDLNLDDQFKGNVCHAFTLEAIIDISAYNERTVKGVPAWLPLGIMSNFEYPLAHTVAALLTGSYTITQFTHNGQKFVRVNRLGTGIPAHPLRMLREGNQAFIQNMVIPRNFSTNQFTYNLTNLVLSVQKLPDDAWRPSKDKLIGNTMHPAVSVHPNLPPIVLPTVKKQAYRQHKNPNNGPLLAISGILHQLRVEKVPEKTSLFRISLPADMFSVKEGMMKKRGENSPVVYFQAPENFPLNGFNNRQVVLAYANPTLSAV |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Promotes virus assbly and budding by interacting with host proteins of the multivesicular body pathway. May facilitate virus budding by interacting with the nucleocapsid and the plasma mbrane. Specific interactions with mbrane-associated GP and VP24 during the budding process may also occur. May play a role in genome replication . |
| Involvement in Disease | |
| Subcellular Location | Virion membrane, Peripheral membrane protein, Host late endosome membrane, Peripheral membrane protein, Host cell membrane, Peripheral membrane protein, Cytoplasmic side, Host endomembrane system, Peripheral membrane protein |
| Protein Families | Filoviridae matrix protein VP40 family |
| Tissue Specificity | VP40 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |