Specification
| Organism | Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) |
| Expression Host | in vitro E.coli expression system |
| Tag Info | C-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9CHU9 |
| Gene Names | lgt |
| Alternative Names | lgt; LL0619; L5776Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase; EC 2.5.1.145 |
| Expression Region | Full Length(1-261aa ) |
| Molecular Weight | 32.6 kDa |
| Protein Sequence | MNNLFPFLALNKIALQLGPLAIHWYAIFIVGGAALAVWLACKEAPKRNIKTDDIIDFVLFAFPLGIVGARLYYVIFQWSYYSQHPSQIIAMWDGGGAIYGSLIAGAIVLFVFSYYRMIHPLDLLDITIPGVFLAQAMGRWGNFVNQEAYGKIVSNLDWLPAFIRNQMFIDGHYRMPTFLFESIGTLSGFILVMVFRHRIKGLKRGDIFSFYLVWYGAVRFIVEGMRTDSLMLGPARVSQWLSVLLVIVGLVLFIYRRMKKN |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Transfers the N-acyl diglyceride group on what will become the N-terminal cysteine of membrane lipoproteins. |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | Lgt family |
| Tissue Specificity | lgt |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
