Recombinant Lactococcus lactis Lipoprotein signal peptidase(lspA)

Specification
Organism Lactococcus lactis
Expression Host in vitro E.coli expression system
Tag Info C-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID A0A089ZE57
Gene Names lspA
Alternative Names Prolipoprotein signal peptidase Signal peptidase II
Expression Region Full Length(1-150aa )
Molecular Weight 19.9 kDa
Protein Sequence MKKLLSLVIIVVGIVADQIFKNWIVANIQLGDTEKIWPNVLSLTYIKNDGAAWSSFSGQQWFFLVLTPIVLVVALWFLWKKMAQNWYFIGLTLIIAGALGNFIDRIRQGFVVDMFQTEFINFPIFNIADILLSVGFVLLFIAILTDKETK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity lspA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$1,625.00
In stock
SKU
EB-PC9Ba2744

Recombinant Lactococcus lactis Lipoprotein signal peptidase(lspA)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Lactococcus lactis Lipoprotein signal peptidase(lspA)
Copyright © 2021-present Echo Biosystems. All rights reserved.