Specification
| Organism | Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P56512 |
| Gene Names | ldh1 |
| Alternative Names | ldh1; l-ldhL; ldh; ldhL; ldhL1; lp_0537L-lactate dehydrogenase 1; L-LDH 1; EC 1.1.1.27 |
| Expression Region | Full Length(1-320aa ) |
| Molecular Weight | 61.2 kDa |
| Protein Sequence | MSSMPNHQKVVLVGDGAVGSSYAFAMAQQGIAEEFVIVDVVKDRTKGDALDLEDAQAFTAPKKIYSGEYSDCKDADLVVITAGAPQKPGESRLDLVNKNLNILSSIVKPVVDSGFDGIFLVAANPVDILTYATWKFSGFPKDRVIGSGTSLDSSRLRVALGKQFNVDPRSVDAYIMGEHGDSEFAAYSTATIGTRPVRDVAKEQGVSDEDLAKLEDGVRNKAYDIINLKGATFYGIGTALMRISKAILRDENAVLPVGAYMDGQYGLNDIYIGTPAVIGGTGLKQIIESPLSADELKKMQDSAATLKKVLNDGLAELENK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm |
| Protein Families | LDH/MDH superfamily, LDH family |
| Tissue Specificity | ldh1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
