Specification
| Organism | Klebsiella pneumoniae (strain 342) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | B5XTL1 |
| Gene Names | arnT |
| Alternative Names | 4-amino-4-deoxy-L-arabinose lipid A transferase Lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase Undecaprenyl phosphate-alpha-L-Ara4N transferase |
| Expression Region | Partial(429-551aa ) |
| Molecular Weight | 17.8 kDa |
| Protein Sequence | RVIDSKQPQFLVDIVSESLQPSRYVLTNNVGIAGGLAWELKRSDIIMFDKQGELKYGLDWPDAQGSFVSQAGFADWLATHRQQGPVSLVLLMDKGESMVDLPLPKPDNAYELGRVVFLQYLPQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Catalyzes the transfer of the L-Ara4N moiety of the glycolipid undecaprenyl phosphate-alpha-L-Ara4N to lipid A. The modified arabinose is attached to lipid A and is required for resistance to polymyxin and cationic antimicrobial peptides. Catalytic activity 4-amino-4-deoxy-alpha-L-arabinopyranosyl di-trans,octa-cis-undecaprenyl phosphate + lipid IV(A) = lipid II(A) + di-trans,octa-cis-undecaprenyl phosphate. Pathway: 4-amino-4-deoxy-beta-L-arabinose-lipid A biosynthesis This protein is involved in the pathway 4-amino-4-deoxy-beta-L-arabinose-lipid A biosynthesis, which is part of Lipopolysaccharide metabolism. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | arnT |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |