Specification
| Organism | Klebsiella pneumoniae (strain 342) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10XHis-B2M-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | B5Y1J4 |
| Gene Names | bamA |
| Alternative Names | bamA; yaeT; KPK_4543Outer membrane protein assembly factor BamA |
| Expression Region | Partial(24-172aa ) |
| Molecular Weight | 33.3 kDa |
| Protein Sequence | FVVKDIHFEGLQRVAVGAALLSMPVRPGDTVTDDDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEG |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Constitutes, with BamD, the core component of the assembly machinery. |
| Involvement in Disease | |
| Subcellular Location | Cell outer membrane |
| Protein Families | BamA family |
| Tissue Specificity | bamA |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |