Recombinant Klebsiella pneumoniae Outer membrane protein A(ompA),partial

Specification
Organism Klebsiella pneumoniae
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P24017
Gene Names ompA
Alternative Names Outer membrane porin A (Outer membrane protein 3A)
Expression Region Partial(190-344aa )
Molecular Weight 24.0 kDa
Protein Sequence GQEDAAPVVAPAPAPAPEVATKHFTLKSDVLFNFNKATLKPEGQQALDQLYTQLSNMDPKDGSAVVLGYTDRIGSEAYNQQLSEKRAQSVVDYLVAKGIPAGKISARGMGESNPVTGNTCDNVKARAALIDCLAPDRRVEIEVKGYKEVVTQPQA
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity ompA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEKBG340712

Recombinant Klebsiella pneumoniae Outer membrane protein A(ompA),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Klebsiella pneumoniae Outer membrane protein A(ompA),partial
Copyright © 2026-present Echo Bio. All rights reserved.