Specification
| Organism | Klebsiella pneumoniae |
| Expression Host | E.coli |
| Protein Tag | N-terminal 6xHis-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | D6QLY3 |
| Gene Names | OmpK36 |
| Alternative Names | (Outer membrane protein C)(Phosphoporin PhoE)(Porin OmpK36) |
| Expression Region | 22-372aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.41 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-133℃. |
| Protein Length | Full Length of Mature Protein |
| Molecular Weight | 42.8 kDa |
| Protein Sequence | AEIYNKDGNKLDLYGKIDGLHYFSDDKSVDGDQTYMRVGVKGETQINDQLTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSVSGEGTSPTNNGRGALKQNGDGFGTSLTYDIYDGISAGFAYSHSKRNGDQNRLDKGRGDNAETYTGGLKYDANNIYLATQYTQTYNATRFSGNGESDSISGFANKAQNFEVVAQYQFDFGLRPSVAYLQSKGKDIEGYGDQDLLKYVDVGATYYFNKNMSTYVDYKINLLDENDFTRRAGISTDDVVALGLVYQF |
Background
| Research Areas | Others |
| Relevance | |
| Function | |
| Reference | "Built-in CTX-M extended-spectrum beta-lactamase gene in Klebsiella pneumoniae ensuring stable propagation of the multidrug-resistant pathogen in clinical settings." Yoon E.-J., Gwon B., Liu C., Kim D., Won D., Park S.G., Choi J.R., Jeong S.H. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |