Specification
Organism | Influenza B virus (strain B/Yamagata/1/1973) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P08014 |
Gene Names | NS |
Alternative Names | NEP (Non-structural protein 2) (NS2) |
Expression Region | Full Length(1-122aa ) |
Molecular Weight | 18.4 kDa |
Protein Sequence | MADNMTTTQIEWRMKKMAIGSSTHSSSVLMKDIQSQFEQLKLRWESYPNLVKSTDYHQRRETIRLVTEELYLLSKRIDDNILFHKTVIANSSIIADMIVSLSLLETLYEMKDVVEVYSRQCL |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Mediates the nuclear export of encapsidated genomic RNAs . Acts as an adapter between viral RNPs complexes and the nuclear export machinery of the cell. Possesses no intrinsic RNA-binding activity, but includes a C-terminal M1-binding domain. This domain is believed to allow recognition of RNPs bound to the protein M1. Since protein M1 is not available in large quantities before late stages of infection, such an indirect recognition mechanism probably ensures that genomic RNPs are not exported from the host nucleus until sufficient quantities of viral mRNA and progeny genomic RNA have been synthesized. Furthermore, the RNPs enter the host cytoplasm only when associated with the M1 protein that is necessary to guide them to the plasma membrane. May down-regulate viral RNA synthesis when overproduced. |
Involvement in Disease | |
Subcellular Location | |
Protein Families | |
Tissue Specificity | NS |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |