Recombinant Hymenolepis diminuta Dihydrolipoyl dehydrogenase

Specification
Organism Hymenolepis diminuta (Rat tapeworm)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P80647
Gene Names N/A
Alternative Names Dihydrolipoamide dehydrogenase
Expression Region Full Length(1-53aa )
Molecular Weight 10.3 kDa
Protein Sequence LSSGEKDLVVIGSGPGGYVAAIKAAQLGMLTVCIEKYPTFGGTCLNVGCIPSK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Lipoamide dehydrogenase is a component of the glycine cleavage system as well as of the alpha-ketoacid dehydrogenase complexes (By similarity). This enzyme has lipoamide dehydrogenase activity and NADH -> NAD transhydrogenation activity. Also displays some NADH-ferricyanide reductase and NADPH -> NAD transydrogenation activities.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity N/A
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEHRJ7053

Recombinant Hymenolepis diminuta Dihydrolipoyl dehydrogenase

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Hymenolepis diminuta Dihydrolipoyl dehydrogenase
Copyright © 2021-present Echo Biosystems. All rights reserved.