Specification
    
        | Organism | Homo sapiens (Human) | 
| Expression Host | Mammalian cell | 
| Protein Tag | C-terminal 10xHis-tagged | 
| Purity | Greater than 95% as determined by SDS-PAGE. | 
| Endotoxin Level | Less than 1.0 EU/ug as determined by LAL method. | 
| Biological Activity | Measured by its binding ability in a functional ELISA. Please contact us for the specific data. | 
| Uniprot ID | Q96DA0 | 
| Gene Names | ZG16B | 
| Alternative Names | |
| Expression Region | 53-208aa | 
| Product Form | Lyophilized powder | 
| Buffer | Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.21 | 
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-382℃. | 
| Protein Length | Full Length of Mature Protein | 
| Molecular Weight | 20.0 kDa | 
| Protein Sequence | GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR | 
        Background
    
        | Research Areas | Cancer | 
        QC Data
    
        | Note | Please contact us for QC Data | 
| Product Image (Reference Only) | ![]()  |  
